PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28293.2 Da    PI: 6.7771
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513865.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.4e-29959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ien   rqvtfskRrng+lKKA+ELS+LCdaevaviifs tgklye+ss
  XP_004513865.1  9 KKIENLNSRQVTFSKRRNGLLKKAKELSILCDAEVAVIIFSGTGKLYEFSS 59
                    68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.716161IPR002100Transcription factor, MADS-box
CDDcd002652.77E-41269No hitNo description
SuperFamilySSF554555.49E-32271IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.08590180IPR002487Transcription factor, K-box
PfamPF014864.1E-1395174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009910Biological Processnegative regulation of flower development
GO:0048577Biological Processnegative regulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGKIEIKK IENLNSRQVT FSKRRNGLLK KAKELSILCD AEVAVIIFSG TGKLYEFSST  60
SMEHIFSRYG RGLNSNGAEQ QPSDQPPAEV VEHDSDTTLL QEEITKLRSD YLRMTGKELD  120
GLDLKELQYL ENQLCEGILA VKNKKEQVLL EQLKRSRLQE QKAMMENEAL RKQLEEIEKK  180
RKAEFLEFHS LDRTIISMNG SKPLSNFCSE DNEISDTCLQ LGLSSDYGRK RKALKIEPCN  240
DSGSQVASQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q2e-19169169Myocyte-specific enhancer factor 2B
1tqe_R2e-19169169Myocyte-specific enhancer factor 2B
1tqe_S2e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513865.10.0PREDICTED: agamous-like MADS-box protein AGL18
SwissprotQ9M2K89e-66AGL18_ARATH; Agamous-like MADS-box protein AGL18
TrEMBLA0A072VJL71e-138A0A072VJL7_MEDTR; MADS-box transcription factor
STRINGGLYMA02G33040.11e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35823260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.15e-67AGAMOUS-like 18